Structure of PDB 4osg Chain B

Receptor sequence
>4osgB (length=159) Species: 1244085 (Klebsiella pneumoniae CG43) [Search protein sequence]
MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGRLTWESI
GRPLPGRKNIVISSKPGSDDRVQWVSSVEEAIAACGDVEEIMVIGGGRVY
EQFLPKAQKLYLTHIDAEVEGDTHFPDYDPDEWESVFSEFHDADAQNSHS
YCFEILERR
3D structure
PDB4osg Crystal Structures of Klebsiella pneumoniae Dihydrofolate Reductase Bound to Propargyl-Linked Antifolates Reveal Features for Potency and Selectivity.
ChainB
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NAP B A6 A7 I14 G15 A19 M20 R44 L45 T46 I62 S63 S64 I94 G96 G97 R98 T123 A6 A7 I14 G15 A19 M20 R44 L45 T46 I62 S63 S64 I94 G96 G97 R98 T123
BS02 06U B I5 M20 D27 L28 F31 M42 I50 L54 I94 I5 M20 D27 L28 F31 M42 I50 L54 I94
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 04:22:13 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4osg', asym_id = 'B', title = 'Crystal Structures of Klebsiella pneumoniae Dihy...tes Reveal Features for Potency and Selectivity. '
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4osg', asym_id='B', title='Crystal Structures of Klebsiella pneumoniae Dihy...tes Reveal Features for Potency and Selectivity. ')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0004146,0046654,0050661', uniprot = '', pdbid = '4osg', asym_id = 'B'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004146,0046654,0050661', uniprot='', pdbid='4osg', asym_id='B')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>