Structure of PDB 4orb Chain B

Receptor sequence
>4orbB (length=165) Species: 10090 (Mus musculus) [Search protein sequence]
SYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLV
QRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDG
YISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCA
VVGGLDIHKKMVVDV
3D structure
PDB4orb Cooperative autoinhibition and multi-level activation mechanisms of calcineurin
ChainB
Resolution3.108 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA B D62 D64 N66 E68 V69 D70 E73 D58 D60 N62 E64 V65 D66 E69
BS02 CA B D99 D101 D103 Y105 E110 D95 D97 D99 Y101 E106
BS03 CA B D140 D142 D144 R146 E151 D136 D138 D140 R142 E147
BS04 CA B D30 D32 S34 S36 E41 D26 D28 S30 S32 E37
Gene Ontology
Molecular Function
GO:0004721 phosphoprotein phosphatase activity
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0008597 calcium-dependent protein serine/threonine phosphatase regulator activity
GO:0019902 phosphatase binding
GO:0019904 protein domain specific binding
GO:0046872 metal ion binding
Biological Process
GO:0001569 branching involved in blood vessel morphogenesis
GO:0001837 epithelial to mesenchymal transition
GO:0006606 protein import into nucleus
GO:0007507 heart development
GO:0014044 Schwann cell development
GO:0022011 myelination in peripheral nervous system
GO:0033173 calcineurin-NFAT signaling cascade
GO:0034504 protein localization to nucleus
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0060487 lung epithelial cell differentiation
GO:0070886 positive regulation of calcineurin-NFAT signaling cascade
GO:0098693 regulation of synaptic vesicle cycle
GO:0099149 regulation of postsynaptic neurotransmitter receptor internalization
GO:0099170 postsynaptic modulation of chemical synaptic transmission
GO:1905665 positive regulation of calcium ion import across plasma membrane
GO:1905949 negative regulation of calcium ion import across plasma membrane
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005955 calcineurin complex
GO:0008287 protein serine/threonine phosphatase complex
GO:0042383 sarcolemma
GO:0045202 synapse
GO:0098685 Schaffer collateral - CA1 synapse
GO:0098686 hippocampal mossy fiber to CA3 synapse
GO:0098688 parallel fiber to Purkinje cell synapse
GO:0098794 postsynapse
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4orb, PDBe:4orb, PDBj:4orb
PDBsum4orb
PubMed
UniProtQ63810|CANB1_MOUSE Calcineurin subunit B type 1 (Gene Name=Ppp3r1)

[Back to BioLiP]