Structure of PDB 4onn Chain B

Receptor sequence
>4onnB (length=149) Species: 9606 (Homo sapiens) [Search protein sequence]
AGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGT
FKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQI
RTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN
3D structure
PDB4onn Covalent Inhibition of Ubc13 Affects Ubiquitin Signaling and Reveals Active Site Elements Important for Targeting.
ChainB
Resolution1.5 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) C87
Catalytic site (residue number reindexed from 1) C86
Enzyme Commision number 2.3.2.23: E2 ubiquitin-conjugating enzyme.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BY1 B N79 V80 D81 C87 N123 N78 V79 D80 C86 N122
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004842 ubiquitin-protein transferase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016740 transferase activity
GO:0019787 ubiquitin-like protein transferase activity
GO:0031625 ubiquitin protein ligase binding
GO:0043130 ubiquitin binding
GO:0061631 ubiquitin conjugating enzyme activity
GO:0097027 ubiquitin-protein transferase activator activity
Biological Process
GO:0000209 protein polyubiquitination
GO:0000724 double-strand break repair via homologous recombination
GO:0000729 DNA double-strand break processing
GO:0006281 DNA repair
GO:0006282 regulation of DNA repair
GO:0006301 postreplication repair
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0006513 protein monoubiquitination
GO:0016567 protein ubiquitination
GO:0043123 positive regulation of canonical NF-kappaB signal transduction
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0045739 positive regulation of DNA repair
GO:0050852 T cell receptor signaling pathway
GO:0051092 positive regulation of NF-kappaB transcription factor activity
GO:0070534 protein K63-linked ubiquitination
GO:0140374 antiviral innate immune response
GO:1902523 positive regulation of protein K63-linked ubiquitination
GO:1902533 positive regulation of intracellular signal transduction
GO:1904262 negative regulation of TORC1 signaling
GO:2000781 positive regulation of double-strand break repair
Cellular Component
GO:0000151 ubiquitin ligase complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0031371 ubiquitin conjugating enzyme complex
GO:0031372 UBC13-MMS2 complex
GO:0032991 protein-containing complex
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4onn, PDBe:4onn, PDBj:4onn
PDBsum4onn
PubMed25909880
UniProtP61088|UBE2N_HUMAN Ubiquitin-conjugating enzyme E2 N (Gene Name=UBE2N)

[Back to BioLiP]