Structure of PDB 4omf Chain B

Receptor sequence

>4omfB (length=280) Species: 79929 (Methanothermobacter marburgensis str. Marburg)

VLGTYKEIVSARSTDREIQKLAQDGGIVTGLLAYALDEGIIEGAVVAGPG
EEFWKPQPMVAMSSDELKAAAGTKYTFSPNVMMLKKAVRQYGIEKLGTVA
IPCQTMGIRKMQTYPFGVRFLADKIKLLVGIYCMENFPYTSLQTFICEKL
GVSMELVEKMDIGKGKFWVYTQDDVLTLPLKETHGYEQAGCKICKDYVAE
LADVSTGSVGSPDGWSTVITRTDAGDSIFKQAVEAGLFETKPIEEVKPGL
GLLEKLAAQKKEKAEKNIAARKEMGLPTPF

3D structure

• PDB: 4omf The F420-Reducing [NiFe]-Hydrogenase Complex from Methanothermobacter marburgensis, the First X-ray Structure of a Group 3 Family Member.
• Chain: B
• Resolution: 1.71 Å

Enzymatic activity

• Enzyme Commision number: 1.12.98.1: coenzyme F420 hydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	B	I102 P103 C104 C134 M135 E136 C192 C195 K261	I101 P102 C103 C133 M134 E135 C191 C194 K260
BS02	UNK	B	M135 E136 I163	M134 E135 I162
BS03	FAD	B	A23 Q24 D25 G27 I28 V29 T30 A48 A71 G73 T74 K75 Y76 N81 Y133 C134 M135 N137 Y198 G208 S209 V210	A22 Q23 D24 G26 I27 V28 T29 A47 A70 G72 T73 K74 Y75 N80 Y132 C133 M134 N136 Y197 G207 S208 V209

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0016151 nickel cation binding
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0050454 coenzyme F420 hydrogenase activity
• GO:0050660 flavin adenine dinucleotide binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding
• GO:0052592 oxidoreductase activity, acting on CH or CH2 groups, with an iron-sulfur protein as acceptor

External links

• PDB: RCSB:4omf, PDBe:4omf, PDBj:4omf
• PDBsum: 4omf
• PubMed: 24887099
• UniProt: D9PYF6