Structure of PDB 4olt Chain B

Receptor sequence

>4oltB (length=237) Species: 878476 (Pseudomonas sp. LL2(2010))

GTVDLDAPVQKDTAMSLVSSFENSSTDWQAQYGYLEDIADGRGYTGGLIG
FTSGTGDMLELVRAYSASSPGNPLEQYIPALEAVNGTDSHAGLGQGFEQA
WADAAETSEFRAAQDAERDRVYFDPAVAQGKADGLSALGQFAYYDTLVVH
GPGSQRDAFGGIRAEALSAALPPSQGGDETEYLEAFFDARNVIMREEPAH
ADTSRIDTAQRVFLQNGNFDLERPLTWSVYGDQYSLN

3D structure

• PDB: 4olt Structural insights into the substrate-binding mechanism for a novel chitosanase.
• Chain: B
• Resolution: 1.59 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E25 D43 T48
• Catalytic site (residue number reindexed from 1): E22 D40 T45
• Enzyme Commision number: 3.2.1.132: chitosanase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GCS	B	S27 Y233 D235	S24 Y230 D232
BS02	GCS	B	E25 N26 S27 Y233	E22 N23 S24 Y230
BS03	GCS	B	E25 Y37	E22 Y34
BS04	GCS	B	R45 I52 G53 V151 H203	R42 I49 G50 V148 H200
BS05	GCS	B	R45 T58 D60 Y125 V152 H153	R42 T55 D57 Y122 V149 H150
BS06	GCS	B	T58 H153 P155	T55 H150 P152

Gene Ontology

Molecular Function

• GO:0016798 hydrolase activity, acting on glycosyl bonds
• GO:0016977 chitosanase activity

Biological Process

• GO:0005975 carbohydrate metabolic process

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:4olt, PDBe:4olt, PDBj:4olt
• PDBsum: 4olt
• PubMed: 24766439
• UniProt: E1AXU1