Structure of PDB 4oal Chain B

Receptor sequence

>4oalB (length=444) Species: 4577 (Zea mays)

GGRLSVDASDIAEASRDFGGVARAEPMAVFHPRAAGDVAGLVGAAFRSAR
GFRVSARGHGHSISGQAQAAGGVVVDMSARALPVHSAALGGHYVDVWGGE
LWVDVLNWTLSHGGLAPRSWTDYLYLSVGGTLSNAGISGQAFHHGPQISN
VYELDVVTGKGEVVTCSETENPDLFFGVLGGLGQFGIITRARIALERAPK
RVRWIRALYSNFSEFTADQERLISLGRRFDYVEGFVVAAVLYCLEVTKNY
DDETAGSVDQDVDTLLGELNFLPGTVFTTDLPYVDFLDRVHKAELKLRAK
GMWEVPHPWLNLFVPASRIADFDRGVFRGVLGGPVLIYPMNKHKWDPRSS
AVTPDEEVFYLVAFLRSALPGAPESLEALARQNQRILDFCAGTGIGAKQY
LPGHKARHEWAEHFGAARWDRFARLKAEFDPRAILAAGQGIFRP

3D structure

• PDB: 4oal Kinetic and structural investigation of the cytokinin oxidase/dehydrogenase active site.
• Chain: B
• Resolution: 1.9 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H100 D170 E285
• Catalytic site (residue number reindexed from 1): H61 D122 E233
• Enzyme Commision number: 1.5.99.12: cytokinin dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	B	F57 A95 R96 G97 H98 G99 H100 S101 Q105 A106 T169 D170 Y171 L174 S175 G177 G178 S181 N182 G184 I185 I235 I236 W389 Y487	F18 A56 R57 G58 H59 G60 H61 S62 Q66 A67 T121 D122 Y123 L126 S127 G129 G130 S133 N134 G136 I137 I187 I188 W309 Y400
BS02	245	B	D170 V370 W389 N391 L423 L452 Y487 L488	D122 V290 W309 N311 L336 L365 Y400 L401

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0003824 catalytic activity
• GO:0016491 oxidoreductase activity
• GO:0019139 cytokinin dehydrogenase activity
• GO:0050660 flavin adenine dinucleotide binding
• GO:0071949 FAD binding

Biological Process

• GO:0009690 cytokinin metabolic process

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:4oal, PDBe:4oal, PDBj:4oal
• PDBsum: 4oal
• PubMed: 26519657
• UniProt: E3T1W8