Structure of PDB 4o79 Chain B

Receptor sequence

>4o79B (length=211) Species: 3702 (Arabidopsis thaliana)

FPIFMVVRVLGFIIAALVLTWTVHYRGGLALSSDNKDHIFNVHPVMMVIG
LILFNGEAMLAYKSVQGTKNLKKLVHLTLQLTAFILSLIGVWAALKFHID
KGIENFYSLHSWLGLACLFLFAFQWAAGFVTYWYPGGSRNSRASLMPWHV
FLGISIYALALVTATTGILEKVTFLQVNQVITRYSTEAMLVNTMGVLILI
LGGFVILGVVT

3D structure

• PDB: 4o79 Structure and mechanism of a eukaryotic transmembrane ascorbate-dependent oxidoreductase
• Chain: B
• Resolution: 2.003 Å

Enzymatic activity

• Enzyme Commision number: 7.2.1.3: ascorbate ferrireductase (transmembrane).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	F48 H51 P52 M55 L103 H106 N113 F114 S116 H118 S119 G122 C125 T171 G175 I176 E178	F40 H43 P44 M47 L95 H98 N105 F106 S108 H110 S111 G114 C117 T163 G167 I168 E170
BS02	HEM	B	M67 Y70 K71 H84 L85 Q88 F129 Q132 W133 G136 M154 H157 G161	M59 Y62 K63 H76 L77 Q80 F121 Q124 W125 G128 M146 H149 G153
BS03	ASC	B	K77 K81 Y140 R150 A151	K69 K73 Y132 R142 A143

Gene Ontology

Molecular Function

• GO:0000293 ferric-chelate reductase activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0140571 transmembrane ascorbate ferrireductase activity

Biological Process

• GO:0019852 L-ascorbic acid metabolic process
• GO:0055085 transmembrane transport

Cellular Component

• GO:0005794 Golgi apparatus
• GO:0016020 membrane

External links

• PDB: RCSB:4o79, PDBe:4o79, PDBj:4o79
• PDBsum: 4o79
• PubMed: 24449903
• UniProt: Q9SWS1|ACFR2_ARATH Transmembrane ascorbate ferrireductase 2 (Gene Name=CYB561B)