Structure of PDB 4o62 Chain B

Receptor sequence

>4o62B (length=57) Species: 9606 (Homo sapiens)

ENMYVNKVWVQCENENCLKWRLLSSEDSAKVDHDEPWYCFMNTDSRYNNC
SISEEDF

3D structure

• PDB: 4o62 Family-wide Characterization of Histone Binding Abilities of Human CW Domain-containing Proteins.
• Chain: B
• Resolution: 1.78 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	K28 V29 W30 V31 Q32 W41 H54 E56 F78	K7 V8 W9 V10 Q11 W20 H33 E35 F57
BS02	ZN	B	C33 C38 C60 C71	C12 C17 C39 C50

Gene Ontology

Molecular Function

• GO:0008270 zinc ion binding

External links

• PDB: RCSB:4o62, PDBe:4o62, PDBj:4o62
• PDBsum: 4o62
• PubMed: 26933034
• UniProt: Q504Y3|ZCPW2_HUMAN Zinc finger CW-type PWWP domain protein 2 (Gene Name=ZCWPW2)