Structure of PDB 4nnm Chain B

Receptor sequence
>4nnmB (length=112) Species: 9606 (Homo sapiens) [Search protein sequence]
VTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVT
RVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLL
VTRQSLQKAVQQ
3D structure
PDB4nnm A CAL Inhibitor with Single-PDZ Specificity Rescues deltaF508-CFTR
ChainB
Resolution1.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B I29 L30 G31 F32 S33 I34 G36 Q40 Q44 N45 T59 H91 R95 L98 T99 I20 L21 G22 F23 S24 I25 G27 Q31 Q35 N36 T50 H82 R86 L89 T90
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008013 beta-catenin binding
Biological Process
GO:0007266 Rho protein signal transduction
GO:0008285 negative regulation of cell population proliferation
GO:0016055 Wnt signaling pathway
GO:0030178 negative regulation of Wnt signaling pathway
GO:0090630 activation of GTPase activity
GO:2000009 negative regulation of protein localization to cell surface
Cellular Component
GO:0001650 fibrillar center
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0015629 actin cytoskeleton
GO:0043231 intracellular membrane-bounded organelle
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4nnm, PDBe:4nnm, PDBj:4nnm
PDBsum4nnm
PubMed
UniProtO14907|TX1B3_HUMAN Tax1-binding protein 3 (Gene Name=TAX1BP3)

[Back to BioLiP]