Structure of PDB 4njv Chain B

Receptor sequence

>4njvB (length=99) Species: 11676 (Human immunodeficiency virus 1)

PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEDMELPGRWKPRMIGGI
GGFVKVRQYDQIPIEICGHKVIGTVLVGPTPTNIIGRNLMTQLGFTLNF

3D structure

• PDB: 4njv A Conserved Hydrogen-Bonding Network of P2 bis-Tetrahydrofuran-Containing HIV-1 Protease Inhibitors (PIs) with a Protease Active-Site Amino Acid Backbone Aids in Their Activity against PI-Resistant HIV.
• Chain: B
• Resolution: 1.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D25 T26 G27
• Catalytic site (residue number reindexed from 1): D25 T26 G27

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	RIT	B	R8 D25 G27 D30 G48 G49 I50 P81 T82	R8 D25 G27 D30 G48 G49 I50 P81 T82

Gene Ontology

Molecular Function

• GO:0004190 aspartic-type endopeptidase activity

Biological Process

• GO:0006508 proteolysis

External links

• PDB: RCSB:4njv, PDBe:4njv, PDBj:4njv
• PDBsum: 4njv
• PubMed: 24752271
• UniProt: Q9J006