Structure of PDB 4nbu Chain B

Receptor sequence

>4nbuB (length=244) Species: 161544 (Bacillus sp. SG-1)

HMSRLQDKVAIITGAANGIGLEAARVFMKEGAKVVIADFNEAAGKEAVEA
NPGVVFIRVDVSDRESVHRLVENVAERFGKIDILINNAGITRDSMLSKMT
VDQFQQVINVNLTGVFHCTQAVLPYMAEQGKGKIINTSSVTGTYGNVGQT
NYAAAKAGVIGMTKTWAKELARKGINVNAVAPGFTETAMVAEVPEKVIEK
MKAQVPMGRLGKPEDIANAYLFLASHESDYVNGHVLHVDGGIMM

3D structure

• PDB: 4nbu Biochemical and Structural Studies of NADH-Dependent FabG Used To Increase the Bacterial Production of Fatty Acids under Anaerobic Conditions.
• Chain: B
• Resolution: 1.34 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAI	B	G20 N23 G24 I25 D44 F45 V65 D66 V67 N93 A94 G95 I96 T143 S145 Y158 K162 P188 F190 T191 T193 M195	G14 N17 G18 I19 D38 F39 V59 D60 V61 N87 A88 G89 I90 T137 S139 Y152 K156 P182 F184 T185 T187 M189
BS02	CAA	B	D99 K104 S145 N152 V153 Q155 Y158 F190 M195 K206	D93 K98 S139 N146 V147 Q149 Y152 F184 M189 K200

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Thu Dec 12 12:52:51 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4nbu', asym_id = 'B', title = 'Biochemical and Structural Studies of NADH-Depen...ction of Fatty Acids under Anaerobic Conditions. '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4nbu', asym_id='B', title='Biochemical and Structural Studies of NADH-Depen...ction of Fatty Acids under Anaerobic Conditions. ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0016491', uniprot = '', pdbid = '4nbu', asym_id = 'B'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016491', uniprot='', pdbid='4nbu', asym_id='B')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>