Structure of PDB 4n1g Chain B

Receptor sequence

>4n1gB (length=194) Species: 32570 (Obelia longissima) [Search protein sequence]

ASKYAVKLKTDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDIC
AKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQYLDGWKQLATSELK
KWARNEPTLIREWGDAVFDIFDKDGSGTITLDEWKAYGKISGISPSQEDC
EATFRHCDLDNSGDLDVDEMTRQHLGFWYTLDPEADGLYGNGVP

3D structure

PDB

4n1g Crystal structures of the F88Y obelin mutant before and after bioluminescence provide molecular insight into spectral tuning among hydromedusan photoproteins

Chain

Resolution

1.5 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	H22 W92 Y138 H175 Y190
Catalytic site (residue number reindexed from 1)	H21 W91 Y137 H174 Y189
Enzyme Commision number	?

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CEI	B	H22 M25 F28 L29 A46 I50 Y88 W92 W114 G115 V118 Y138 S142 M171 H175 W179 Y190	H21 M24 F27 L28 A45 I49 Y87 W91 W113 G114 V117 Y137 S141 M170 H174 W178 Y189
BS02	CA	B	D159 D161 S163 D165 E170	D158 D160 S162 D164 E169
BS03	CA	B	D123 D125 S127 T129 E134	D122 D124 S126 T128 E133
BS04	CA	B	D30 N32 N34 K36 E41	D29 N31 N33 K35 E40

Gene Ontology

	Molecular Function
GO:0005509	calcium ion binding
GO:0046872	metal ion binding

	Biological Process
GO:0008218	bioluminescence

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4n1g, PDBe:4n1g, PDBj:4n1g
PDBsum	4n1g
PubMed	24418253
UniProt	Q27709\|OBL_OBELO Obelin

[Back to BioLiP]