Structure of PDB 4mx3 Chain B

Receptor sequence
>4mx3B (length=269) Species: 9913 (Bos taurus) [Search protein sequence]
AASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFI
AGETVIQQGDEGDNFYVIDQGEMDVYVNNEWATSVGEGGSFGELALIYGT
PRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESL
DKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSAAVLQRRSEN
EEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVL
GPCSDILKRNIQQYNSFVS
3D structure
PDB4mx3 PKA RI alpha Homodimer Structure Reveals an Intermolecular Interface with Implications for Cooperative cAMP Binding and Carney Complex Disease.
ChainB
Resolution3.88 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CMP B V182 G199 E200 L201 A202 R209 A210 A211 W260 V75 G92 E93 L94 A95 R102 A103 A104 W153
BS02 CMP B V300 F322 G323 E324 I325 A326 R333 V337 N372 V193 F215 G216 E217 I218 A219 R226 V230 N265
Gene Ontology
Molecular Function
GO:0004862 cAMP-dependent protein kinase inhibitor activity
GO:0005515 protein binding
GO:0008603 cAMP-dependent protein kinase regulator activity
GO:0019904 protein domain specific binding
GO:0030552 cAMP binding
GO:0031625 ubiquitin protein ligase binding
GO:0034236 protein kinase A catalytic subunit binding
GO:0042802 identical protein binding
Biological Process
GO:0001707 mesoderm formation
GO:0001932 regulation of protein phosphorylation
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007507 heart development
GO:0010629 negative regulation of gene expression
GO:0032024 positive regulation of insulin secretion
GO:0045214 sarcomere organization
GO:0046007 negative regulation of activated T cell proliferation
GO:0060038 cardiac muscle cell proliferation
GO:0071377 cellular response to glucagon stimulus
GO:0141162 negative regulation of cAMP/PKA signal transduction
Cellular Component
GO:0001772 immunological synapse
GO:0005737 cytoplasm
GO:0005771 multivesicular body
GO:0005813 centrosome
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005930 axoneme
GO:0005952 cAMP-dependent protein kinase complex
GO:0031588 nucleotide-activated protein kinase complex
GO:0031594 neuromuscular junction
GO:0032991 protein-containing complex
GO:0044853 plasma membrane raft
GO:0045202 synapse
GO:0098978 glutamatergic synapse
GO:0120212 sperm head-tail coupling apparatus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4mx3, PDBe:4mx3, PDBj:4mx3
PDBsum4mx3
PubMed24316401
UniProtP00514|KAP0_BOVIN cAMP-dependent protein kinase type I-alpha regulatory subunit (Gene Name=PRKAR1A)

[Back to BioLiP]