Structure of PDB 4mv5 Chain B

Receptor sequence

>4mv5B (length=310) Species: 83333 (Escherichia coli K-12)

MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHEVVHNRYVVDSLR
ERGAIFIEQISEVPDGAILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVT
KVHMEVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPDDV
WKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYAT
TNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKD
IQEEWVKEVKCVGVTAGASAPDILVQNVVARLQQLGGGEAIPLEGREENI
VFEVPKELRV

3D structure

• PDB: 4mv5 Insights into the Binding of Pyridines to the Iron-Sulfur Enzyme IspH.
• Chain: B
• Resolution: 1.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	F3S	B	C12 G14 C96 T167 C197	C12 G14 C96 T167 C197
BS02	2E7	B	V40 H41 A73 H74 H124 E126 T168 S225 S226 N227 S269	V40 H41 A73 H74 H124 E126 T168 S225 S226 N227 S269

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 22 17:38:48 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4mv5', asym_id = 'B', title = 'Insights into the Binding of Pyridines to the Iron-Sulfur Enzyme IspH.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4mv5', asym_id='B', title='Insights into the Binding of Pyridines to the Iron-Sulfur Enzyme IspH.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0019288,0046872,0050992,0051745', uniprot = '', pdbid = '4mv5', asym_id = 'B'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0019288,0046872,0050992,0051745', uniprot='', pdbid='4mv5', asym_id='B')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>