Structure of PDB 4mu8 Chain B

Receptor sequence

>4mu8B (length=107) Species: 559292 (Saccharomyces cerevisiae S288C)

EFKAGSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGY
SYTDANIKKNVLWDENNMSEYLTNPAKYIPGTKMAFGGLKKEKDRNDLIT
YLKKASE

3D structure

• PDB: 4mu8 Structure of a mitochondrial cytochrome c conformer competent for peroxidase activity.
• Chain: B
• Resolution: 1.45 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	B	R13 C14 C17 H18 G29 P30 L32 I35 S40 G41 Y48 T49 W59 M64 Y67 L68 T78 K79 F82	R17 C18 C21 H22 G33 P34 L36 I39 S44 G45 Y52 T53 W63 M68 Y71 L72 T82 K83 F86

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:1901612 cardiolipin binding

Biological Process

• GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
• GO:0006123 mitochondrial electron transport, cytochrome c to oxygen

Cellular Component

• GO:0005739 mitochondrion
• GO:0005758 mitochondrial intermembrane space

External links

• PDB: RCSB:4mu8, PDBe:4mu8, PDBj:4mu8
• PDBsum: 4mu8
• PubMed: 24760830
• UniProt: P00044|CYC1_YEAST Cytochrome c isoform 1 (Gene Name=CYC1)