Structure of PDB 4md9 Chain B

Receptor sequence

>4md9B (length=195) Species: 9606 (Homo sapiens) [Search protein sequence]

EVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILD
LEPPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRV
YCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTG
FPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNF

3D structure

PDB

4md9 Active Form of the Protein Kinase CK2 alpha 2 beta 2 Holoenzyme Is a Strong Complex with Symmetric Architecture.

Chain

Resolution

3.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	C109 C114 C137 C140	C97 C102 C125 C128

Gene Ontology

	Molecular Function
GO:0003682	chromatin binding
GO:0004674	protein serine/threonine kinase activity
GO:0005102	signaling receptor binding
GO:0005515	protein binding
GO:0019887	protein kinase regulator activity
GO:0019904	protein domain specific binding
GO:0030674	protein-macromolecule adaptor activity
GO:0042802	identical protein binding
GO:0046872	metal ion binding
GO:0061629	RNA polymerase II-specific DNA-binding transcription factor binding

	Biological Process
GO:0007165	signal transduction
GO:0008285	negative regulation of cell population proliferation
GO:0016055	Wnt signaling pathway
GO:0018107	peptidyl-threonine phosphorylation
GO:0032435	negative regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0032927	positive regulation of activin receptor signaling pathway
GO:0033211	adiponectin-activated signaling pathway
GO:0043537	negative regulation of blood vessel endothelial cell migration
GO:0051101	regulation of DNA binding
GO:0060391	positive regulation of SMAD protein signal transduction
GO:0061154	endothelial tube morphogenesis
GO:0065003	protein-containing complex assembly
GO:0075342	symbiont-mediated disruption of host cell PML body
GO:1903901	negative regulation of viral life cycle

	Cellular Component
GO:0000785	chromatin
GO:0005576	extracellular region
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0005956	protein kinase CK2 complex
GO:0016605	PML body
GO:0031519	PcG protein complex
GO:0034774	secretory granule lumen
GO:0070062	extracellular exosome
GO:1904813	ficolin-1-rich granule lumen

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4md9, PDBe:4md9, PDBj:4md9
PDBsum	4md9
PubMed	24175891
UniProt	P67870\|CSK2B_HUMAN Casein kinase II subunit beta (Gene Name=CSNK2B)

[Back to BioLiP]