Structure of PDB 4m4m Chain B

Receptor sequence
>4m4mB (length=30) Species: 9913 (Bos taurus) [Search protein sequence]
FVNQHLCGSHLVEALYLVCGERGFFYTPKA
3D structure
PDB4m4m Towards accurate structural characterization of metal centres in protein crystals: the structures of Ni and Cu T6 bovine insulin derivatives.
ChainB
Resolution1.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B F1 N3 Q4 H5 L6 C7 L11 V18 C19 R22 G23 F24 F25 Y26 P28 K29 F1 N3 Q4 H5 L6 C7 L11 V18 C19 R22 G23 F24 F25 Y26 P28 K29
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4m4m, PDBe:4m4m, PDBj:4m4m
PDBsum4m4m
PubMed24419384
UniProtP01317|INS_BOVIN Insulin (Gene Name=INS)

[Back to BioLiP]