Structure of PDB 4m30 Chain B

Receptor sequence

>4m30B (length=218) Species: 224324 (Aquifex aeolicus VF5)

MLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIV
DLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINE
TIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDY
KTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSK
KEAEQRAAEELIKLLEES

3D structure

• PDB: 4m30 RNase III: Genetics and Function; Structure and Mechanism.
• Chain: B
• Resolution: 2.501 Å

Enzymatic activity

• Enzyme Commision number: 3.1.26.3: ribonuclease III.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	D44 S68 A72 I75 S76 D151 K153 T154 Q157 E158 Q161 R167 K203	D42 S66 A70 I73 S74 D149 K151 T152 Q155 E156 Q159 R165 K201
BS02	rna	B	H27 V28 R97 N101 T103 H179 H180 F184 K200 S201 K202	H25 V26 R95 N99 T101 H177 H178 F182 K198 S199 K200
BS03	MG	B	D44 E110	D42 E108
BS04	MG	B	E40 E110	E38 E108
BS05	A	B	S68 K71	S66 K69
BS06	A	B	F41 D44 E110	F39 D42 E108

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003725 double-stranded RNA binding
• GO:0004519 endonuclease activity
• GO:0004525 ribonuclease III activity
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006364 rRNA processing
• GO:0006396 RNA processing
• GO:0006397 mRNA processing
• GO:0008033 tRNA processing
• GO:0010468 regulation of gene expression

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4m30, PDBe:4m30, PDBj:4m30
• PDBsum: 4m30
• PubMed: 24274754
• UniProt: O67082|RNC_AQUAE Ribonuclease 3 (Gene Name=rnc)