Structure of PDB 4m2z Chain B

Receptor sequence

>4m2zB (length=218) Species: 224324 (Aquifex aeolicus VF5)

MLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIV
DLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINE
TIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDY
KTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSK
KEAEQRAAEELIKLLEES

3D structure

• PDB: 4m2z RNase III: Genetics and Function; Structure and Mechanism.
• Chain: B
• Resolution: 2.85 Å

Enzymatic activity

• Enzyme Commision number: 3.1.26.3: ribonuclease III.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	D44 E64 G65 A72 I75 S76 D151 K153 T154 Q157 E158 Q161 K165 R167 K203	D42 E62 G63 A70 I73 S74 D149 K151 T152 Q155 E156 Q159 K163 R165 K201
BS02	rna	B	H27 R97 T103 H179 H180 F184 K200 S201 K202	H25 R95 T101 H177 H178 F182 K198 S199 K200
BS03	MG	B	D44 E110	D42 E108
BS04	C	B	S68 K71	S66 K69
BS05	C	B	E40 F41 D44	E38 F39 D42

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003725 double-stranded RNA binding
• GO:0004519 endonuclease activity
• GO:0004525 ribonuclease III activity
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006364 rRNA processing
• GO:0006396 RNA processing
• GO:0006397 mRNA processing
• GO:0008033 tRNA processing
• GO:0010468 regulation of gene expression

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4m2z, PDBe:4m2z, PDBj:4m2z
• PDBsum: 4m2z
• PubMed: 24274754
• UniProt: O67082|RNC_AQUAE Ribonuclease 3 (Gene Name=rnc)