Structure of PDB 4m1u Chain B |
>4m1uB (length=70) Species: 562 (Escherichia coli) [Search protein sequence] |
ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVT IKSSTCESGSGFAEVQFNND |
|
PDB | 4m1u The crystal structure of shiga toxin type 2 with bound disaccharide guides the design of a heterobifunctional toxin inhibitor. |
Chain | B |
Resolution | 1.56 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
1PS |
B |
N14 D16 T18 W29 |
N14 D16 T18 W29 |
|
|
|
|