Structure of PDB 4lji Chain B

Receptor sequence
>4ljiB (length=131) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
GVDNYVIQYLKVTDTVELPVNDRGETKTFTAVDLTRGKRLFEENCKNCHV
GGSTLPNPLVSLSLKDLKGATPPRDTIASLVAFQRSPKSYDGSEESYSCR
RVSEDWLTTEQLETLAAFILRAAAVAPGWGV
3D structure
PDB4lji Crystal structure at 1.5 angstrom resolution of the PsbV2 cytochrome from the cyanobacterium Thermosynechococcus elongatus
ChainB
Resolution1.508 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEC B N46 C47 C50 H51 T56 V62 S63 L64 D68 R76 F85 Q86 Y92 S98 S100 C101 R102 N44 C45 C48 H49 T54 V60 S61 L62 D66 R74 F83 Q84 Y90 S96 S98 C99 R100
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0015979 photosynthesis
GO:0022904 respiratory electron transport chain
Cellular Component
GO:0009523 photosystem II
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4lji, PDBe:4lji, PDBj:4lji
PDBsum4lji
PubMed23994160
UniProtQ8DJE2|PSBV2_THEVB Cytochrome c-550-like protein (Gene Name=psbV2)

[Back to BioLiP]