Structure of PDB 4l41 Chain B |
>4l41B (length=122) Species: 9606 (Homo sapiens) [Search protein sequence] |
AKQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTE YGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIK GIDYWLAHKALCTEKLEQWLCE |
|
PDB | 4l41 Crystal Structure of Human Lactose Synthase forms a Novel 1:2 Complex between beta1,4Galactosyltransferase 1 and alpha-Lactalbumin Proteins |
Chain | B |
Resolution | 2.7 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
N46 S48 S57 |
Catalytic site (residue number reindexed from 1) |
N46 S48 S57 |
Enzyme Commision number |
? |
|
|
|
|