Structure of PDB 4l1a Chain B |
>4l1aB (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
PQITLWQRPIVTIKIGGQLKEALLNTGADDTVLEEVNLPGRWKPKLIGGI GGFVKVRQYDQVPIEICGHKTIGTVLVGPTPTNVIGRNLMTQIGCTLNF |
|
PDB | 4l1a Crystallographic study of multi-drug resistant HIV-1 protease lopinavir complex: mechanism of drug recognition and resistance. |
Chain | B |
Resolution | 1.9 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
N25 T26 G27 |
Catalytic site (residue number reindexed from 1) |
N25 T26 G27 |
Enzyme Commision number |
3.1.26.13: retroviral ribonuclease H. |
|
|
|
|