Structure of PDB 4kr6 Chain B

Receptor sequence

>4kr6B (length=388) Species: 243274 (Thermotoga maritima MSB8)

MEELRVYIVRYSEIGLKGKNRKDFEEALRRNIERVTGMKVKRQWGRFLIP
IDENVTLDDKLKKIFGIQNFSKGFLVSHDFEEVKKYSLIAVKEKLEKGNY
RTFKVQAKKAYKEYKKGVYEINSELGALILKNFKELSVDVRNPDFVLGVE
VRPEGVLIFTDRVECYGGLPVGTGGKAVLLLSGGIDSPVAGWYALKRGVL
IESVTFVSPPFTSEGAVEKVRDILRVLREFSGGHPLRLHIVNLTKLQLEV
KKRVPDKYSLIMYRRSMFRIAEKIAEETGAVAFYTGENIGQVASQTLENL
WSIESVTTRPVIRPLSGFDKTEIVEKAKEIGTYEISIKPYQDSCVFFAPK
NPATRSHPSILEKLEQQVPDLPVLEEEAFTSRKVEVIE

3D structure

• PDB: 4kr6 Crystal structure of a 4-thiouridine synthetase-RNA complex reveals specificity of tRNA U8 modification.
• Chain: B
• Resolution: 2.85 Å

Enzymatic activity

• Enzyme Commision number: 2.8.1.4: tRNA uracil 4-sulfurtransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	R10 Y11 S12 E13 E25 R42 W44 G45 R46 Q68 K104 V105 Q106 K108 K109 V118 Y119 N122 S123 G126 A127 V138 V140 R141 R152	R10 Y11 S12 E13 E25 R42 W44 G45 R46 Q68 K104 V105 Q106 K108 K109 V118 Y119 N122 S123 G126 A127 V138 V140 R141 R152
BS02	rna	B	K257 Y333 P339 N351 A353 T354	K257 Y333 P339 N351 A353 T354

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0004810 CCA tRNA nucleotidyltransferase activity
• GO:0005524 ATP binding
• GO:0016740 transferase activity
• GO:0016783 sulfurtransferase activity
• GO:0140741 tRNA-uracil-4 sulfurtransferase activity

Biological Process

• GO:0002937 tRNA 4-thiouridine biosynthesis
• GO:0009228 thiamine biosynthetic process
• GO:0009229 thiamine diphosphate biosynthetic process
• GO:0034227 tRNA thio-modification
• GO:0052837 thiazole biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:4kr6, PDBe:4kr6, PDBj:4kr6
• PDBsum: 4kr6
• PubMed: 24705700
• UniProt: Q9X220|THII_THEMA Probable tRNA sulfurtransferase (Gene Name=thiI)