Structure of PDB 4kh0 Chain B

Receptor sequence

>4kh0B (length=150) Species: 595495 (Escherichia coli KO11FL)

DNKLQVEAIKRGTVIDHIPAQIGFKLLSLFKLTETDQRITIGLNLPSGEM
GRKDLIKIENTFLSEDQVDQLALYAPQATVNRIDNYEVVGKSRPSLPERI
DNVLVCPNSNCISHAEPVSSSFAVRKRANDIALKCKYCEKEFSHNVVLAN

3D structure

• PDB: 4kh0 New Paradigm for Allosteric Regulation of Escherichia coli Aspartate Transcarbamoylase.
• Chain: B
• Resolution: 2.25 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	C109 C114 C138 C141	C106 C111 C135 C138
BS02	ATP	B	A11 I12 V17 D19 H20 K60 N84 I86 Y89 V91 K94	A8 I9 V14 D16 H17 K57 N81 I83 Y86 V88 K91
BS03	ATP	B	H20 T43 L48 P49 S50 G51 E52 K56 K60	H17 T40 L45 P46 S47 G48 E49 K53 K57
BS04	ATP	B	K6 L7	K3 L4
BS05	ATP	B	K6 V9 E10	K3 V6 E7

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Wed Dec 18 18:53:09 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4kh0', asym_id = 'B', title = 'New Paradigm for Allosteric Regulation of Escherichia coli Aspartate Transcarbamoylase.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4kh0', asym_id='B', title='New Paradigm for Allosteric Regulation of Escherichia coli Aspartate Transcarbamoylase.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0006207,0009347', uniprot = '', pdbid = '4kh0', asym_id = 'B'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006207,0009347', uniprot='', pdbid='4kh0', asym_id='B')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>