Structure of PDB 4kgz Chain B

Receptor sequence
>4kgzB (length=144) Species: 595495 (Escherichia coli KO11FL) [Search protein sequence]
EAIKRGTVIDHIPAQIGFKLLSLFKLTETDQRITIGLNLPSGEMGRKDLI
KIENTFLSEDQVDQLALYAPQATVNRIDNYEVVGKSRPSLPERIDNVLVC
PNSNCISHAEPVSSSFAVRKRANDIALKCKYCEKEFSHNVVLAN
3D structure
PDB4kgz New Paradigm for Allosteric Regulation of Escherichia coli Aspartate Transcarbamoylase.
ChainB
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN B C109 C114 C138 C141 C100 C105 C129 C132
BS02 UTP B A11 I12 V17 H20 K60 Y89 K94 A2 I3 V8 H11 K51 Y80 K85
BS03 UTP B E10 H20 P49 S50 K56 K60 E1 H11 P40 S41 K47 K51
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Dec 1 14:57:35 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4kgz', asym_id = 'B', title = 'New Paradigm for Allosteric Regulation of Escherichia coli Aspartate Transcarbamoylase.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4kgz', asym_id='B', title='New Paradigm for Allosteric Regulation of Escherichia coli Aspartate Transcarbamoylase.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0006207,0009347', uniprot = '', pdbid = '4kgz', asym_id = 'B'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006207,0009347', uniprot='', pdbid='4kgz', asym_id='B')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>