Structure of PDB 4kfz Chain B

Receptor sequence
>4kfzB (length=148) Species: 9606 (Homo sapiens) [Search protein sequence]
SLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCD
LCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTM
RVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKING
3D structure
PDB4kfz Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
ChainB
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN B C30 C33 H51 C54 C22 C25 H43 C46
BS02 ZN B C57 C60 C80 D83 C49 C52 C72 D75
BS03 ZN B C94 C97 H116 C119 C86 C89 H108 C111
BS04 ZN B C122 C125 C144 D147 C114 C117 C136 D139
Gene Ontology
Molecular Function
GO:0001221 transcription coregulator binding
GO:0003713 transcription coactivator activity
GO:0005515 protein binding
GO:0043425 bHLH transcription factor binding
GO:0046872 metal ion binding
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
GO:0140297 DNA-binding transcription factor binding
Biological Process
GO:0045944 positive regulation of transcription by RNA polymerase II
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005667 transcription regulator complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4kfz, PDBe:4kfz, PDBj:4kfz
PDBsum4kfz
PubMed24407558
UniProtP25791|RBTN2_HUMAN Rhombotin-2 (Gene Name=LMO2)

[Back to BioLiP]