Structure of PDB 4kb0 Chain B

Receptor sequence

>4kb0B (length=204) Species: 83333 (Escherichia coli K-12)

TGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTT
LHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGI
KASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGL
ALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGW
PLSA

3D structure

• PDB: 4kb0 Structural insights into DNA repair by RNase T--an exonuclease processing 3' end of structured DNA in repair pathways.
• Chain: B
• Resolution: 2.004 Å

Enzymatic activity

• Enzyme Commision number: 3.1.13.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	R15 R140 N141 H144 F146	R8 R133 N134 H137 F139
BS02	dna	B	E25 T26 F29 E73 A74 F77 H120 N121 F124 V163 L164	E18 T19 F22 E66 A67 F70 H113 N114 F117 V156 L157
BS03	MG	B	D23 E25 H181 D186	D16 E18 H174 D179

Gene Ontology

Molecular Function

• GO:0000175 3'-5'-RNA exonuclease activity
• GO:0000287 magnesium ion binding
• GO:0003676 nucleic acid binding
• GO:0004527 exonuclease activity
• GO:0004540 RNA nuclease activity
• GO:0005515 protein binding
• GO:0008310 single-stranded DNA 3'-5' DNA exonuclease activity
• GO:0008408 3'-5' exonuclease activity
• GO:0016896 RNA exonuclease activity, producing 5'-phosphomonoesters
• GO:0042802 identical protein binding
• GO:0042803 protein homodimerization activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006259 DNA metabolic process
• GO:0006396 RNA processing
• GO:0006974 DNA damage response
• GO:0008033 tRNA processing
• GO:0031125 rRNA 3'-end processing
• GO:0034644 cellular response to UV
• GO:0042780 tRNA 3'-end processing
• GO:0043628 regulatory ncRNA 3'-end processing
• GO:0045004 DNA replication proofreading

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:4kb0, PDBe:4kb0, PDBj:4kb0
• PDBsum: 4kb0
• PubMed: 24594808
• UniProt: P30014|RNT_ECOLI Ribonuclease T (Gene Name=rnt)