Structure of PDB 4k38 Chain B

Receptor sequence

>4k38B (length=362) Species: 195103 (Clostridium perfringens ATCC 13124)

PPLSLLIKPASSGCNLKCTYCFYHSVKSYGIMRDEVLESMVKRVLNEANG
HCSFAFQGGEPTLAGLEFFEKLMELQRKHNYKNLKIYNSLQTNGTLIDES
WAKFLSENKFLVGLSMDGPKEIHNLNRKDCCGLDTFSKVERAAELFKKYK
VEFNILCVVTSNTARHVNKVYKYFKEKDFKFLQFINCLDPLYEEKGKYNY
SLKPKDYTKFLKNLFDFWYEDFLNGNRVSIRYFDGLLETILLGKSSSCGM
NGTCTCQFVVESDGSVYPCDFYVLDKWRLGNIQDMTMKELFETNKNHEFI
KLSFKVHEECKKCKWFRLCKGGCRRCRDSKEDSALELNYYCQSYKEFFEY
AFPRLINVANNI

3D structure

• PDB: 4k38 X-ray structure of an AdoMet radical activase reveals an anaerobic solution for formylglycine posttranslational modification.
• Chain: B
• Resolution: 1.831 Å

Enzymatic activity

• Enzyme Commision number: 1.8.98.7: cysteine-type anaerobic sulfatase-maturating enzyme.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	Q64 Q98 L118 G120 E159 F160 N161 F188 Q190 R238 E245 S253 C255 C330	Q57 Q91 L111 G113 E152 F153 N154 F181 Q183 R231 E238 S246 C248 C323
BS02	SF4	B	C255 G256 C261 T262 Q264 C276 F278 C330 R331 R332	C248 G249 C254 T255 Q257 C269 F271 C323 R324 R325
BS03	SF4	B	E316 C317 C320 F323 C326 C348 K352	E309 C310 C313 F316 C319 C341 K345
BS04	SF4	B	C15 L17 C19 C22 H25 G66 N100 R134	C14 L16 C18 C21 H24 G59 N93 R127
BS05	SAM	B	Y21 F23 Y24 G65 G66 E67 Q98 T99 S122 R134 V165 I192 N193 C194 L195	Y20 F22 Y23 G58 G59 E60 Q91 T92 S115 R127 V158 I185 N186 C187 L188

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

External links

• PDB: RCSB:4k38, PDBe:4k38, PDBj:4k38
• PDBsum: 4k38
• PubMed: 23650368
• UniProt: Q0TTH1|ANSME_CLOP1 Cysteine-type anaerobic sulfatase-maturating enzyme (Gene Name=CPF_0616)