Structure of PDB 4k37 Chain B

Receptor sequence

>4k37B (length=367) Species: 195103 (Clostridium perfringens ATCC 13124)

PLSLLIKPASSGCNLKCTYCFYHSLSDNRNVKSYGIMRDEVLESMVKRVL
NEANGHCSFAFQGGEPTLAGLEFFEKLMELQRKHNYKNLKIYNSLQTNGT
LIDESWAKFLSENKFLVGLSMDGPKEIHNLNRKDCCGLDTFSKVERAAEL
FKKYKVEFNILCVVTSNTARHVNKVYKYFKEKDFKFLQFINCLDPLYEEK
GKYNYSLKPKDYTKFLKNLFDFWYEDFLNGNRVSIRYFDGLLETILLGKS
SSCGMNGTCTCQFVVESDGSVYPCDFYVLDKWRLGNIQDMTMKELFETNK
NHEFIKLSFKVHEECKKCKWFRLCKGGCRRCRDSKEDSALELNYYCQSYK
EFFEYAFPRLINVANNI

3D structure

• PDB: 4k37 X-ray structure of an AdoMet radical activase reveals an anaerobic solution for formylglycine posttranslational modification.
• Chain: B
• Resolution: 1.62 Å

Enzymatic activity

• Enzyme Commision number: 1.8.98.7: cysteine-type anaerobic sulfatase-maturating enzyme.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	B	C255 G256 C261 T262 Q264 C276 F278 C330 R331 R332	C253 G254 C259 T260 Q262 C274 F276 C328 R329 R330
BS02	SF4	B	E316 C317 C320 F323 C326 G328 C348 K352	E314 C315 C318 F321 C324 G326 C346 K350
BS03	SF4	B	C15 L17 C19 C22 G66 N100 R134	C13 L15 C17 C20 G64 N98 R132
BS04	SAM	B	Y21 F23 Y24 G65 G66 E67 T99 S122 R134 V165 I192 L195	Y19 F21 Y22 G63 G64 E65 T97 S120 R132 V163 I190 L193

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

External links

• PDB: RCSB:4k37, PDBe:4k37, PDBj:4k37
• PDBsum: 4k37
• PubMed: 23650368
• UniProt: Q0TTH1|ANSME_CLOP1 Cysteine-type anaerobic sulfatase-maturating enzyme (Gene Name=CPF_0616)