Structure of PDB 4k1i Chain B

Receptor sequence

>4k1iB (length=388) Species: 382827 (Influenza A virus (A/RI/5+/1957(H2N2)))

VEYRNWSKPQCQITGFAPFSKDNSIRLSAGGDIWVTREPYVSCDPGKCYQ
FALGQGTTLDNKHSNDTVHDRIPHRTLLMNELGVPFHLGTRQVCIAWSSS
SCHDGKAWLHVCITGDDKNATASFIYDGRLVDSIGSWSQNILRTQESECV
CINGTCTVVMTDGSASGRADTRILFIEEGKIVHISPLSGSAQHIEECSCY
PRYPGVRCICRDNWKGSNRPVVDINMEDYSIDSSYVCSGLVGDTPRNDDS
SSNSNCRNPNNERGTQGVKGWAFDNGNDLWMGRTISKESRSGYETFKVIG
GWSTPNSKSQVNRQVIVDNNNWSGYSGIFSVEGKSCINRCFYVELIRGRP
QETRVWWTSNSIVVFCGTSGTYGTGSWPDGANINFMPI

3D structure

• PDB: 4k1i Induced opening of influenza virus neuraminidase N2 150-loop suggests an important role in inhibitor binding
• Chain: B
• Resolution: 1.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D151 E277 R292 R371 Y406
• Catalytic site (residue number reindexed from 1): D70 E196 R211 R290 Y325
• Enzyme Commision number: 3.2.1.18: exo-alpha-sialidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BMA	B	Q391 V392 R394	Q310 V311 R313
BS02	MAN	B	Q391 R394	Q310 R313
BS03	CA	B	D293 G297 D324 G345 Q347	D212 G216 D243 G264 Q266
BS04	G39	B	E119 D151 R152 R224 E276 R292 N294 R371 Y406	E38 D70 R71 R143 E195 R211 N213 R290 Y325

Gene Ontology

Molecular Function

• GO:0004308 exo-alpha-sialidase activity

Biological Process

• GO:0005975 carbohydrate metabolic process
• GO:0046761 viral budding from plasma membrane

Cellular Component

• GO:0016020 membrane
• GO:0033644 host cell membrane
• GO:0055036 virion membrane

External links

• PDB: RCSB:4k1i, PDBe:4k1i, PDBj:4k1i
• PDBsum: 4k1i
• PubMed: 23531861
• UniProt: Q194T1