Structure of PDB 4jws Chain B

Receptor sequence

>4jwsB (length=395) Species: 303 (Pseudomonas putida)

NLAPLPPHVPEHLVFDFDMYNPSNLSAGVQEAWAVLQESNVPDLVWTRSN
GGHWIATRGQLIREAYEDYRHFSSESPFIPRESMDPPEQRQFRALANQVV
GMPVVDKLENRIQELASSLIESLRPQGQCNFTEDYAEPFPIRIFMLLAGL
PEEDIPHLKYLTDQMTRPDGSMTFAEAKEALYDYLIPIIEQRRQKPGTDA
ISIVANGQVNGRPITSDEAKRMCGLLLVGGLDTVVNFLSFSMEFLAKSPE
HRQELIERPERIPAASEELLRRFSLVADGRILTSDYEFHGVQLKKGDQIL
LPQMLSGLDERENAAPMHVDFSRQCVSHTTFGHGSHLCLGQHLARREIIV
TLKEWLTRIPDFSIAPGAQIQHKSGIVSGVQALPLVWDPATTKAV

3D structure

• PDB: 4jws Structural basis for effector control and redox partner recognition in cytochrome P450.
• Chain: B
• Resolution: 2.15 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R186 G248 D251 T252 V253 C357 L358 G359 E366 V396
• Catalytic site (residue number reindexed from 1): R167 G229 D232 T233 V234 C338 L339 G340 E347 V377
• Enzyme Commision number: 1.14.15.1: camphor 5-monooxygenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	R112 L245 G248 G249 T252 V253 D297 R299 Q322 T349 F350 G351 H355 C357 L358	R93 L226 G229 G230 T233 V234 D278 R280 Q303 T330 F331 G332 H336 C338 L339
BS02	CA	B	E198 D202	E179 D183
BS03	1N0	B	Y78 S83 P105 S354 H355	Y69 S74 P86 S335 H336

Gene Ontology

Molecular Function

• GO:0004497 monooxygenase activity
• GO:0005506 iron ion binding
• GO:0005515 protein binding
• GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
• GO:0018683 camphor 5-monooxygenase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0019383 (+)-camphor catabolic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4jws, PDBe:4jws, PDBj:4jws
• PDBsum: 4jws
• PubMed: 23744947
• UniProt: P00183|CPXA_PSEPU Camphor 5-monooxygenase (Gene Name=camC)