Structure of PDB 4jvm Chain B

Receptor sequence
>4jvmB (length=290) Species: 9606 (Homo sapiens) [Search protein sequence]
SELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTW
VSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPR
IVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPG
SFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKE
VIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLS
PFMRKGITGDWKNHFTEALNEKFDKHYEQQMKESTLKFRT
3D structure
PDB4jvm Mimicking of Estradiol Binding by Flame Retardants and Their Metabolites: A Crystallographic Analysis.
ChainB
Resolution1.994 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) K47 H107 S137
Catalytic site (residue number reindexed from 1) K45 H105 S135
Enzyme Commision number 2.8.2.4: estrone sulfotransferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 XDI B F80 C83 M89 K105 H107 F141 Y239 I246 F254 F78 C81 M87 K103 H105 F139 Y237 I244 F252 MOAD: ic50=33nM
BS02 A3P B K47 G49 T50 T51 W52 R129 S137 Y192 F228 M255 R256 K257 G258 K45 G47 T48 T49 W50 R127 S135 Y190 F226 M253 R254 K255 G256
Gene Ontology
Molecular Function
GO:0004062 aryl sulfotransferase activity
GO:0004304 estrone sulfotransferase activity
GO:0005496 steroid binding
GO:0005515 protein binding
GO:0008146 sulfotransferase activity
GO:0016740 transferase activity
GO:0047894 flavonol 3-sulfotransferase activity
GO:0050294 steroid sulfotransferase activity
Biological Process
GO:0006068 ethanol catabolic process
GO:0006629 lipid metabolic process
GO:0006711 estrogen catabolic process
GO:0008202 steroid metabolic process
GO:0008210 estrogen metabolic process
GO:0045600 positive regulation of fat cell differentiation
GO:0050427 3'-phosphoadenosine 5'-phosphosulfate metabolic process
GO:0051923 sulfation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0031965 nuclear membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4jvm, PDBe:4jvm, PDBj:4jvm
PDBsum4jvm
PubMed23959441
UniProtP49888|ST1E1_HUMAN Sulfotransferase 1E1 (Gene Name=SULT1E1)

[Back to BioLiP]