Structure of PDB 4jv8 Chain B

Receptor sequence
>4jv8B (length=147) Species: 9606 (Homo sapiens) [Search protein sequence]
SAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPK
KILKCKAVSRELNFSSTEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNS
TNTWQSLIEAASQMMPASVLTGNVIIETKFFDDDLLVSTSRVRLFYV
3D structure
PDB4jv8 Small molecule inhibition of the KRAS PDEd interaction impairs oncogenic KRAS signalling
ChainB
Resolution1.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 1M1 B L17 M20 W32 L38 R61 Q78 W90 L147 L16 M19 W31 L37 R60 Q77 W89 L144 PDBbind-CN: -logKd/Ki=5.85,Kd=1.42uM
BS02 1M1 B I53 C56 V80 E88 I109 A111 M117 Y149 I52 C55 V79 E87 I108 A110 M114 Y146 PDBbind-CN: -logKd/Ki=5.85,Kd=1.42uM
Gene Ontology
Molecular Function
GO:0005095 GTPase inhibitor activity
GO:0005515 protein binding
GO:0031267 small GTPase binding
Biological Process
GO:0007601 visual perception
GO:0050953 sensory perception of light stimulus
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005929 cilium
GO:0016020 membrane
GO:0030659 cytoplasmic vesicle membrane
GO:0031410 cytoplasmic vesicle
GO:0042995 cell projection

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4jv8, PDBe:4jv8, PDBj:4jv8
PDBsum4jv8
PubMed23698361
UniProtO43924|PDE6D_HUMAN Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta (Gene Name=PDE6D)

[Back to BioLiP]