Structure of PDB 4jv6 Chain B

Receptor sequence
>4jv6B (length=146) Species: 9606 (Homo sapiens) [Search protein sequence]
SAKDERAREILRGFKLNWMNLRDATGKILWQGTEDLSVPGVEHEARVPKK
ILKCKAVSRELNFSSTEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNST
NTWQSLIEAASQMMPASVLTGNVIIETKFFDDDLLVSTSRVRLFYV
3D structure
PDB4jv6 Small molecule inhibition of the KRAS PDEd interaction impairs oncogenic KRAS signalling
ChainB
Resolution1.87 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 18F B M20 W32 A47 R61 Q78 I129 M19 W30 A45 R59 Q76 I125 MOAD: Kd=217nM
PDBbind-CN: -logKd/Ki=6.66,Kd=217nM
BindingDB: Kd=2400nM
BS02 18F B I53 L54 C56 W90 I109 A111 M117 L147 Y149 I51 L52 C54 W88 I107 A109 M113 L143 Y145 MOAD: Kd=217nM
PDBbind-CN: -logKd/Ki=6.66,Kd=217nM
BindingDB: Kd=2400nM
Gene Ontology
Molecular Function
GO:0005095 GTPase inhibitor activity
GO:0005515 protein binding
GO:0031267 small GTPase binding
Biological Process
GO:0007601 visual perception
GO:0050953 sensory perception of light stimulus
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005929 cilium
GO:0016020 membrane
GO:0030659 cytoplasmic vesicle membrane
GO:0031410 cytoplasmic vesicle
GO:0042995 cell projection

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4jv6, PDBe:4jv6, PDBj:4jv6
PDBsum4jv6
PubMed23698361
UniProtO43924|PDE6D_HUMAN Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta (Gene Name=PDE6D)

[Back to BioLiP]