Structure of PDB 4jph Chain B

Receptor sequence
>4jphB (length=111) Species: 10090 (Mus musculus) [Search protein sequence]
KEVLASSQEALVVTERKYLKSDWCKTQPLRQTVSEEGCRSRTILNRFCYG
QCNSFYIPRHVKKEEDSFQSCAFCKPQRVTSVIVELECPGLDPPFRIKKI
QKVKHCRCMSV
3D structure
PDB4jph Structure of protein related to dan and cerberus: insights into the mechanism of bone morphogenetic protein antagonism.
ChainB
Resolution2.25 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GSH B Q118 C120 Q69 C71
Gene Ontology
Molecular Function
GO:0005125 cytokine activity
GO:0008201 heparin binding
GO:0036122 BMP binding
GO:0042802 identical protein binding
Biological Process
GO:0009966 regulation of signal transduction
GO:0010172 embryonic body morphogenesis
GO:0019221 cytokine-mediated signaling pathway
GO:0030514 negative regulation of BMP signaling pathway
GO:0038098 sequestering of BMP from receptor via BMP binding
GO:0048263 determination of dorsal identity
GO:0060300 regulation of cytokine activity
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4jph, PDBe:4jph, PDBj:4jph
PDBsum4jph
PubMed23850456
UniProtO88273|GREM2_MOUSE Gremlin-2 (Gene Name=Grem2)

[Back to BioLiP]