Structure of PDB 4jo6 Chain B

Receptor sequence

>4jo6B (length=120) Species: 1895 (Streptomyces avidinii)

AGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAP
ATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGT
TEANAWKSTLVGHDTFTKVK

3D structure

• PDB: 4jo6 The structure of the SBP-Tag-streptavidin complex reveals a novel helical scaffold bridging binding pockets on separate subunits
• Chain: B
• Resolution: 1.75 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	N23 Q24 L25 S27 Y43 S45 V47 S52 W79 R84 S88 T90 W108 S112 W120 L124 D128	N9 Q10 L11 S13 Y29 S31 V33 S38 W65 R70 S74 T76 W94 S98 W106 L110 D114

Gene Ontology

Molecular Function

• GO:0009374 biotin binding

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:4jo6, PDBe:4jo6, PDBj:4jo6
• PDBsum: 4jo6
• PubMed: 23633599
• UniProt: P22629|SAV_STRAV Streptavidin