Structure of PDB 4jna Chain B

Receptor sequence

>4jnaB (length=293) Species: 536 (Chromobacterium violaceum)

LFDVIVIGGSHAGQSAALQIARARRRVLVIDAGARRNRFASQSHGVIGQD
GRSPDAIAADGKAQLLAYPNAQWREDSVVRAERSDAGYTLICASGQHYRA
CQLVLAFGVVDELPELEGLEERWGESVFHCPYCHGYELDGGRIGVLGSGP
LSYLSAMLMPEWGQTVFLTDASFEPDEEQREALARRGVEIVRDRIARIVD
RATVELADGRRIAFDGLFTMNRMRLSSPVAEQLGCAIEEGPLGPYVRTDD
AMETSTPGVFACGDITHRGGTVALAIGNGALAGIAAHRKLVFG

3D structure

• PDB: 4jna The structural basis of an NADP+-independent dithiol oxidase in FK228 biosynthesis.
• Chain: B
• Resolution: 2.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	C177 P288 H314 R315 G316	C130 P241 H267 R268 G269
BS02	peptide	B	I331 R335	I284 R288
BS03	FAD	B	I54 S57 A59 I77 D78 A79 A81 R83 N84 S90 H91 S124 V125 F154 C180 H181 S273 G310 D311 G317 T318 V319	I7 S10 A12 I30 D31 A32 A34 R36 N37 S43 H44 S77 V78 F107 C133 H134 S226 G263 D264 G270 T271 V272

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0004791 thioredoxin-disulfide reductase (NADPH) activity
• GO:0016491 oxidoreductase activity

Biological Process

• GO:0045454 cell redox homeostasis
• GO:0098869 cellular oxidant detoxification

External links

• PDB: RCSB:4jna, PDBe:4jna, PDBj:4jna
• PDBsum: 4jna
• PubMed: 24553401
• UniProt: A4ZPY8