Structure of PDB 4jl5 Chain B

Receptor sequence
>4jl5B (length=203) Species: 224324 (Aquifex aeolicus VF5) [Search protein sequence]
MILVFLGPPGAGKGTQAKRLAKEKGFVHISTGDILREAVQKGTPLGKKAK
EYMERGELVPDDLIIALIEEVFPKHGNVIFDGFPRTVKQAEALDEMLEKK
GLKVDHVLLFEVPDEVVIERLSGRRINPETGEVYHVKYNPPPPGVKVIQR
EDDKPEVIKKRLEVYREQTAPLIEYYKKKGILRIIDASKPVEEVYRQVLE
VIG
3D structure
PDB4jl5 The energy landscape of adenylate kinase during catalysis.
ChainB
Resolution1.24 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) K13 R85 R124 R150 R161
Catalytic site (residue number reindexed from 1) K13 R85 R124 R150 R161
Enzyme Commision number 2.7.4.3: adenylate kinase.
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 ADP B T31 L35 R36 M53 E57 L58 V59 I64 G82 R85 Q89 R124 R150 R161 T31 L35 R36 M53 E57 L58 V59 I64 G82 R85 Q89 R124 R150 R161
BS02 ADP B G10 G12 K13 G14 T15 R120 R124 Y134 H135 Y138 V191 G10 G12 K13 G14 T15 R120 R124 Y134 H135 Y138 V191
Gene Ontology
Molecular Function
GO:0004017 adenylate kinase activity
GO:0004550 nucleoside diphosphate kinase activity
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0016776 phosphotransferase activity, phosphate group as acceptor
GO:0019205 nucleobase-containing compound kinase activity
GO:0050145 nucleoside monophosphate kinase activity
Biological Process
GO:0006139 nucleobase-containing compound metabolic process
GO:0009123 nucleoside monophosphate metabolic process
GO:0009132 nucleoside diphosphate metabolic process
GO:0009165 nucleotide biosynthetic process
GO:0016310 phosphorylation
GO:0044209 AMP salvage
GO:0046940 nucleoside monophosphate phosphorylation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4jl5, PDBe:4jl5, PDBj:4jl5
PDBsum4jl5
PubMed25580578
UniProtO66490|KAD_AQUAE Adenylate kinase (Gene Name=adk)

[Back to BioLiP]