Structure of PDB 4jh8 Chain B

Receptor sequence
>4jh8B (length=138) Species: 222523 (Bacillus cereus ATCC 10987) [Search protein sequence]
MLNGINHLCFSVSNLEDSIEFYEKVLEGELLVRGRKLAYFNICGVWVALN
EEIHIPRNEIYQSYTHIAFSVEQKDFESLLQRLEENDVHILKGRERDVRD
CESIYFVDPDGHKFEFHSGTLQDRLNYYREDKPHMTFY
3D structure
PDB4jh8 Structural and Chemical Aspects of Resistance to the Antibiotic Fosfomycin Conferred by FosB from Bacillus cereus.
ChainB
Resolution1.41 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.5.1.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FCN B H7 C9 H7 C9
BS02 ZN B H66 E115 H66 E115
BS03 CYS B C101 E102 S118 C101 E102 S118
BS04 FCN B Y64 H66 R94 Y105 E115 R124 Y64 H66 R94 Y105 E115 R124
BS05 CYS B Y64 R94 Y64 R94
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0016740 transferase activity
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups
GO:0046872 metal ion binding
Biological Process
GO:0046677 response to antibiotic
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4jh8, PDBe:4jh8, PDBj:4jh8
PDBsum4jh8
PubMed24004181
UniProtQ739M9|FOSB_BACC1 Metallothiol transferase FosB (Gene Name=fosB)

[Back to BioLiP]