Structure of PDB 4jgj Chain B |
>4jgjB (length=104) Species: 10090 (Mus musculus) [Search protein sequence] |
ALLTSKEMRFSAAEGAKVLLSVPDLLSFSWYKGKDVNENFTIAHYKKSSD SLQLGKKVSGREEIYKDGSMMLRAITLEDTGFYTLQTFKGQQEVTHVHLQ VYKI |
|
PDB | 4jgj Crystal structure of the Ig-like D1 domain of CEACAM15 from Mus musculus [NYSGRC-005691] |
Chain | B |
Resolution | 2.6508 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
B |
L30 T31 S32 K33 |
L3 T4 S5 K6 |
|
|
|