Structure of PDB 4jal Chain B

Receptor sequence

>4jalB (length=155) Species: 83333 (Escherichia coli K-12)

MALNIVLYEPEIPPNTGNIIRLCANTGFRLHIIEPMGFAWDDKRLRRAGL
DYHEFTAVTRHHDYRAFLEAENPQRLFALTTKGTPAHSAVSYQDGDYLMF
GPETRGLPASILDALPAEQKIRIPMVPDSRSMNLSNAVSVVVYEAWRQLG
YPGAV

3D structure

• PDB: 4jal The tRNA recognition mechanism of the minimalist SPOUT methyltransferase, TrmL
• Chain: B
• Resolution: 2.0 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.207: tRNA (cytidine(34)-2'-O)-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SAH	B	L78 T79 T80 F99 G100 E102 I122 M124 S130 M131	L79 T80 T81 F100 G101 E103 I123 M125 S131 M132	PDBbind-CN: -logKd/Ki=4.60,Kd=25uM

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0008168 methyltransferase activity
• GO:0008173 RNA methyltransferase activity
• GO:0008175 tRNA methyltransferase activity
• GO:0008757 S-adenosylmethionine-dependent methyltransferase activity
• GO:0042803 protein homodimerization activity
• GO:0141098 tRNA (cytidine(34)-2'-O)-methyltransferase activity
• GO:0141102 tRNA (5-carboxymethylaminomethyluridine(34)-2'-O)-methyltransferase activity

Biological Process

• GO:0001510 RNA methylation
• GO:0002131 wobble position cytosine ribose methylation
• GO:0002132 wobble position uridine ribose methylation
• GO:0006396 RNA processing
• GO:0008033 tRNA processing
• GO:0030488 tRNA methylation
• GO:0032259 methylation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4jal, PDBe:4jal, PDBj:4jal
• PDBsum: 4jal
• PubMed: 23804755
• UniProt: P0AGJ7|TRML_ECOLI tRNA (cytidine(34)-2'-O)-methyltransferase (Gene Name=trmL)