Structure of PDB 4izg Chain B

Receptor sequence

>4izgB (length=369) Species: 318586 (Paracoccus denitrificans PD1222)

MKIAEIHVYAHDLPVKDGPYTIASSTVWSLQTTLVKIVADSGLAGWGETC
PVGPTYAPSHALGARAALAEMAPGLIGANPLQPLVLRRRMDGLLCGHNYA
KAAIDIAAYDLMGKHYGVRVADLLGGVAAERVPSYYATGIGQPDEIARIA
AEKVAEGFPRLQIKIGGRPVEIDIETVRKVWERIRGTGTRLAVDGNRSLP
SRDALRLSRECPEIPFVLEQPCNTLEEIAAIRGRVQHGIYLDESGEDLST
VIRAAGQGLCDGFGMKLTRIGGLQQMAAFRDICEARALPHSCDDAWGGDI
IAAACTHIGATVQPRLNEGVWVAQPYIAQPYDEENGIRIAGGHIDLPKGP
GLGITPDESLFGPPVASFS

3D structure

• PDB: 4izg Prediction and biochemical demonstration of a catabolic pathway for the osmoprotectant proline betaine.
• Chain: B
• Resolution: 1.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y20 A137 Q162 K164 D194 N196 V217 E219 D242 E243 K266 D293 D294 A295 E318 G319 V320 W321
• Catalytic site (residue number reindexed from 1): Y20 A137 Q162 K164 D194 N196 V217 E219 D242 E243 K266 D293 D294 A295 E318 G319 V320 W321
• Enzyme Commision number: 5.1.1.22: 4-hydroxyproline betaine 2-epimerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	B	D194 E219 D242	D194 E219 D242
BS02	4OP	B	Y56 Y135 Q162 K164 D194 D242 K266 A295 W321	Y56 Y135 Q162 K164 D194 D242 K266 A295 W321

Gene Ontology

Molecular Function

• GO:0016853 isomerase activity
• GO:0016854 racemase and epimerase activity
• GO:0016855 racemase and epimerase activity, acting on amino acids and derivatives
• GO:0036361 racemase activity, acting on amino acids and derivatives
• GO:0046872 metal ion binding

Biological Process

• GO:0006579 amino-acid betaine catabolic process

External links

• PDB: RCSB:4izg, PDBe:4izg, PDBj:4izg
• PDBsum: 4izg
• PubMed: 24520058
• UniProt: A1B198|HPBD_PARDP 4-hydroxyproline betaine 2-epimerase (Gene Name=hpbD)