Structure of PDB 4itz Chain B |
>4itzB (length=121) Species: 5855 (Plasmodium vivax) [Search protein sequence] |
LEQVHLTEDGGVVKTILRKGEGGEENAPKKGNEVTVHYVGKLESSGKVFD SSRERNVPFKFHLGQGEVIKGWDICVASMTKNEKCSVRLDSKYGYGEEGC GESIPGNSVLIFEIELISFRE |
|
PDB | 4itz Structural insights into substrate binding by PvFKBP35, a peptidylprolyl cis-trans isomerase from the human malarial parasite Plasmodium vivax. |
Chain | B |
Resolution | 1.65 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
B |
G71 V73 |
G66 V68 |
|
|
|
|