Structure of PDB 4iht Chain B

Receptor sequence
>4ihtB (length=90) Species: 62977 (Acinetobacter baylyi ADP1) [Search protein sequence]
MELRHLRYFVAVVEEQSFTKAADKLCIAQPPLSRQIQNLEEELGIQLLER
GSRPVKTTPEGHFFYQYAIKLLSNVDQMVSMTKRIASGHH
3D structure
PDB4iht The DNA-binding domain of BenM reveals the structural basis for the recognition of a T-N11-A sequence motif by LysR-type transcriptional regulators.
ChainB
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B S17 F18 T19 Q29 P30 S33 Q37 S17 F18 T19 Q29 P30 S33 Q37
BS02 dna B R4 Y8 A28 P30 P31 R34 Q35 G51 R53 R4 Y8 A28 P30 P31 R34 Q35 G51 R53
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4iht, PDBe:4iht, PDBj:4iht
PDBsum4iht
PubMed24100318
UniProtO68014|BENM_ACIAD HTH-type transcriptional regulator BenM (Gene Name=benM)

[Back to BioLiP]