Structure of PDB 4i7z Chain B

Receptor sequence

>4i7zB (length=159) Species: 83541 (Mastigocladus laminosus)

ATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACI
VALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLM
ASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPL
DKTLTLGLF

3D structure

• PDB: 4i7z Lipid-induced conformational changes within the cytochrome b6f complex of oxygenic photosynthesis.
• Chain: B
• Resolution: 2.803 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E78
• Catalytic site (residue number reindexed from 1): E77

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	F40 I44	F39 I43
BS02	CLA	B	Y80 V104 P105 I132 F133 G136 V139 T140	Y79 V103 P104 I131 F132 G135 V138 T139
BS03	OZ2	B	E115 N118 R126 V128 A129	E114 N117 R125 V127 A128
BS04	1E2	B	W32 P33 Y38	W31 P32 Y37

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity

Biological Process

• GO:0009767 photosynthetic electron transport chain
• GO:0015979 photosynthesis

Cellular Component

• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:4i7z, PDBe:4i7z, PDBj:4i7z
• PDBsum: 4i7z
• PubMed: 23514009
• UniProt: P83792|PETD_MASLA Cytochrome b6-f complex subunit 4 (Gene Name=petD)