Structure of PDB 4i6s Chain B

Receptor sequence
>4i6sB (length=90) Species: 305 (Ralstonia solanacearum) [Search protein sequence]
SSVQTAATSWGTVPSIRVYTANNGKITERCWDGKGWYTGAFNEPGDNVSV
TSWLVGSAIHIRVYASTGTTTTEWCADGNGWTKGAYTATN
3D structure
PDB4i6s Reduction of lectin valency drastically changes glycolipid dynamics in membranes but not surface avidity
ChainB
Resolution1.54 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FUC B W31 W36 W31 W36
BS02 FUL B W31 W36 W31 W36
BS03 FUC B R17 E28 G39 A40 W81 R17 E28 G39 A40 W81
BS04 FUC B R62 E73 A85 R62 E73 A85
BS05 FUL B R62 E73 A85 R62 E73 A85
External links