Structure of PDB 4hso Chain B

Receptor sequence

>4hsoB (length=343) Species: 122586 (Neisseria meningitidis MC58)

DDIKIKEVKELLPPIAHLYELPISKEASGLVHRTRQEISDLVHGRDKRLL
VIIGPCSIHDPKAALEYAERLLKLRKQYENELLIVMRVYFEKPRTTVGWK
GLINDPHLDGTFDINFGLRQARSLLLSLNNMGMPASTEFLDMITPQYYAD
LISWGAIGARTTESQVHRELASGLSCPVGFKNGTDGNLKIAIDAIGAASH
SHHFLGVTKAGHSAIVHTGGNPDCHVILRGGKEPNYDAEHVSEAAEQLRA
AGVTDKLMIDCSHANSRKDYTRQMEVAQDIAAQLEQDGGNIMGVMVESHL
VEGRQDKPEVYGKSITDACIGWGATEELLALLAGANKKRMARA

3D structure

• PDB: 4hso Neisseria meningitidis expresses a single 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase that is inhibited primarily by phenylalanine.
• Chain: B
• Resolution: 2.1 Å

Enzymatic activity

• Enzyme Commision number: 2.5.1.54: 3-deoxy-7-phosphoheptulonate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	TYR	B	D8 D9	D1 D2	MOAD: Kd=22uM PDBbind-CN: -logKd/Ki=4.66,Kd=22uM
BS02	TYR	B	Q153 A156 L177 L181 S182	Q146 A149 L170 L174 S175	MOAD: Kd=22uM PDBbind-CN: -logKd/Ki=4.66,Kd=22uM
BS03	PEP	B	R94 Y96 A166 K188 R236 H270	R87 Y89 A159 K181 R229 H263
BS04	MN	B	C63 H270 E304 D324	C56 H263 E297 D317

Gene Ontology

Molecular Function

• GO:0003849 3-deoxy-7-phosphoheptulonate synthase activity
• GO:0016740 transferase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0008652 amino acid biosynthetic process
• GO:0009058 biosynthetic process
• GO:0009073 aromatic amino acid family biosynthetic process
• GO:0009423 chorismate biosynthetic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4hso, PDBe:4hso, PDBj:4hso
• PDBsum: 4hso
• PubMed: 23754471
• UniProt: Q9K169