Structure of PDB 4hrh Chain B

Receptor sequence
>4hrhB (length=107) Species: 9606 (Homo sapiens) [Search protein sequence]
PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLA
VDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQENSTVHEI
LSKLSLE
3D structure
PDB4hrh SMARCA3, a Chromatin-Remodeling Factor, Is Required for p11-Dependent Antidepressant Action.
ChainB
Resolution3.001 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B D59 S73 G77 L78 K109 L110 S111 L112 E113 D59 S73 G77 L78 K103 L104 S105 L106 E107
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0008289 lipid binding
GO:0042803 protein homodimerization activity
GO:0044325 transmembrane transporter binding
GO:0048306 calcium-dependent protein binding
Biological Process
GO:0001765 membrane raft assembly
GO:0006900 vesicle budding from membrane
GO:0010756 positive regulation of plasminogen activation
GO:0042789 mRNA transcription by RNA polymerase II
GO:0043547 positive regulation of GTPase activity
GO:0045921 positive regulation of exocytosis
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0050767 regulation of neurogenesis
GO:0051496 positive regulation of stress fiber assembly
GO:0051894 positive regulation of focal adhesion assembly
GO:0072659 protein localization to plasma membrane
GO:1900026 positive regulation of substrate adhesion-dependent cell spreading
GO:1905686 positive regulation of plasma membrane repair
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0009986 cell surface
GO:0016363 nuclear matrix
GO:0045121 membrane raft
GO:0062023 collagen-containing extracellular matrix
GO:0070062 extracellular exosome
GO:0090575 RNA polymerase II transcription regulator complex
GO:0098797 plasma membrane protein complex
GO:1990665 AnxA2-p11 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4hrh, PDBe:4hrh, PDBj:4hrh
PDBsum4hrh
PubMed23415230
UniProtP07355|ANXA2_HUMAN Annexin A2 (Gene Name=ANXA2);
P60903|S10AA_HUMAN Protein S100-A10 (Gene Name=S100A10)

[Back to BioLiP]