Structure of PDB 4hqm Chain B |
>4hqmB (length=100) Species: 1280 (Staphylococcus aureus) [Search protein sequence] |
VCPYLEETFKILGRSWNGLIINYLSRSNDSSAHFSDMKRDLKTITPRALS LKLSELAQWELVEKQIISTSPVQIIYVLTEKGKALAEALHPIEAWAQSYV |
|
PDB | 4hqm Molecular mechanism of quinone signaling mediated through S-quinonization of a YodB family repressor QsrR. |
Chain | B |
Resolution | 2.55 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
17Z |
B |
G21 N25 |
G18 N22 |
|
|
|